SecReT6
Regulator Protein ID: 83716915
SecReT6 ID115
T6SS typeA4b
Gene symbol-
Locus tagBTH_II1510
StrainBurkholderia thailandensis E264
Repliconchromosome I [GenBank: NC_007650] [Browse all T6SS(s) in this replicon]
Location [Strand]1779070..1779789 [-]
ProductLuxR family transcriptional regulator
Regulator typeprotein
Homologous effectorBTH_II1510 (BtaR1)
UniProt IDQ2T543
KEGG IDbte:BTH_II1510
PDB IDNA
Domain hit(s) vs Pfam Autoind_bind [PF03472], Evalue: 2.8e-32, Aligned region: 17-159
GerE [PF00196], Evalue: 6.0e-19, Aligned region: 174-220
Sigma70_r4 [PF04545], Evalue: 4.5e-06, Aligned region: 174-220
Protein Sequence: 239 a.a.     [Download]
>gi|83716915|ref|YP_439706.1| unnamed protein product [Burkholderia thailandensis E264]
MELRWQDAYLQFSAAENEQQLFQQIAAYTKRLGFEYCCYGIRVPLPISKPVVAIFDTYPNGWMERYQEMN
YLEVDPTVRDGALSSNMIVWPEASANDATTLWSDARDHGLAVGVAQSSWASRGVFGLLTIARHTDRLTSA
EINHLTLQANWLANMSHSLMSRFLVPKLAPESGVALTHREREVLCWTGEGKTACEIGQILSISERTVNFH
VNNILDKLGATNKVQAVVKAIAMGLIDTP
-
Nucleotide Sequence: 720 bp     [Download]
>gi|83716035|ref|NC_007650.1|:c1779789-1779070 Burkholderia thailandensis E264 chromosome II, complete sequence
ATGGAACTGCGCTGGCAAGACGCCTATCTTCAATTTAGCGCCGCGGAGAACGAGCAGCAGCTCTTCCAAC
AGATCGCAGCGTATACGAAGCGGCTCGGCTTCGAATATTGCTGCTATGGCATACGTGTGCCGCTGCCGAT
CTCGAAGCCGGTCGTCGCGATCTTCGACACCTATCCGAACGGCTGGATGGAGCGCTATCAGGAAATGAAC
TACCTGGAGGTCGATCCGACCGTGCGCGACGGCGCGCTCAGCTCGAACATGATCGTCTGGCCGGAGGCGA
GCGCGAACGATGCGACGACGCTGTGGAGCGACGCGCGCGATCACGGGCTCGCAGTCGGCGTCGCGCAGTC
GAGCTGGGCATCGCGCGGTGTGTTCGGCCTCCTGACGATCGCGCGGCACACGGACCGCCTGACGTCCGCC
GAGATCAACCATCTGACGCTTCAGGCGAACTGGCTCGCGAACATGTCGCACTCGTTGATGAGCCGCTTCC
TCGTGCCGAAGCTCGCGCCCGAATCGGGCGTGGCGCTCACGCACCGCGAGCGGGAAGTGCTGTGCTGGAC
GGGCGAGGGCAAGACCGCGTGCGAGATCGGCCAGATCCTCAGCATTTCCGAGCGCACGGTGAACTTCCAC
GTCAACAACATCCTCGACAAGCTCGGCGCGACGAACAAGGTGCAGGCCGTCGTGAAGGCGATCGCGATGG
GGCTCATCGATACGCCGTGA

Reference
(1) Charlotte Majerczyk, Emily Schneider, E Peter Greenberg (2016). Quorum Sensing Control of Type VI Secretion Factors Restricts the Proliferation of Quorum-Sensing Mutants. Elife. 5:e14712. [PudMed:27183270] experimental
 
experimental experimental literature