SecReT6
Regulator Protein ID: 560174118
SecReT6 ID929
T6SS typeN/A
Gene symbol-
Locus tagSMDB11_2275
StrainSerratia marcescens Db10
RepliconT6SS [GenBank: HG326223] [Browse all T6SS(s) in this replicon]
Location [Strand]2399154..2400599 [+]
Producttype VI secretion system, serine/threonine protein kinase
Regulator typeprotein
Homologous effectorSMDB11_2275 (PpKA)
UniProt IDNA
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam Pkinase [PF00069], Evalue: 6.6e-26, Aligned region: 23..298
Pkinase_Tyr [PF07714], Evalue: 1.2e-14, Aligned region: 23..295
Protein Sequence: 481 a.a.     [Download]
>gi|560174118|ref|CDG12850.1| type VI secretion system, serine/threonine protein kinase [Serratia marcescens subsp. marcescens Db11]
MSGTGITKPNSNSLPSGYRFNEFEIQEAIGEGGFGIVYRAYDHQLERTIAIKEYMPTSLAKRNDDLSIGL
RGERFSKTFQAGLNSFIQEARLLARFSHPGLLHVLRFWEENGTAYMGTQFYSGTTLKNLQAQQPEKIDEA
WIRRLLPPLFSAINTIHQEGYLHRDISLDNIQIQESQLPVLLDFGSARKEIGNLSDETEIMLKPGFAPIE
QYTENSDGEQGPWTDIYALGAVLHTLIVGSPPPVSVVRSIEDSYQPLAERRPAGYSPELLRTVDRALALK
PEDRPQTIDEMAELLHLPIADENEIISTPAAAPENLLVAANPAAAAAAAGAVTARGTQFSRPMMAGAGVA
ALLVIGAVAWLSGGEDDTQAVAQNTEASPARKTLAEQPSAPQTAQPAAAEPEKVAPPPQPVALVYFKLQP
GEQVSLDGKPQQVTPGANGFASLNLAPGRYQLEIRHDDRLRRQQLSIDTAGTWLVNPATAG
-
Nucleotide Sequence: 1446 bp     [Download]
>gi|560171871|ref|HG326223.1|:2399154-2400599 Serratia marcescens subsp. marcescens Db11 chromosome, complete genome
ATGTCGGGAACCGGGATAACCAAACCGAATTCGAACAGCCTGCCGAGCGGCTATCGATTCAATGAATTCG
AGATCCAGGAAGCGATCGGCGAAGGCGGCTTCGGCATCGTCTACCGCGCCTACGATCACCAACTGGAACG
CACCATCGCCATCAAGGAGTACATGCCAACCTCGCTGGCGAAACGCAACGACGATCTCAGCATCGGGCTG
CGCGGTGAACGCTTCAGCAAAACCTTCCAGGCCGGACTGAACAGCTTTATTCAGGAGGCGCGTCTGCTGG
CGCGCTTCTCGCACCCCGGCCTGCTGCACGTGTTGCGCTTCTGGGAAGAGAACGGCACCGCCTACATGGG
CACCCAGTTTTACAGCGGCACCACGCTGAAGAACCTGCAGGCGCAGCAACCGGAGAAGATCGACGAGGCG
TGGATCCGGCGGCTGCTGCCGCCGCTGTTCAGCGCCATCAACACCATCCACCAGGAAGGCTATCTGCACC
GCGACATTTCGCTGGATAACATCCAGATCCAGGAAAGCCAACTGCCGGTGCTGCTGGACTTCGGATCGGC
GCGTAAAGAGATCGGCAACCTGTCAGACGAAACGGAGATCATGCTCAAACCGGGCTTCGCGCCGATCGAG
CAGTACACCGAGAACAGCGACGGCGAACAGGGGCCCTGGACCGATATCTACGCGCTGGGCGCCGTGCTGC
ACACGCTGATCGTCGGTTCGCCGCCGCCGGTCAGCGTGGTGCGCAGCATCGAAGACAGCTACCAGCCGCT
GGCCGAGCGCCGCCCCGCCGGTTACTCGCCGGAGCTGCTGCGCACCGTCGATCGCGCGCTGGCGCTGAAG
CCGGAAGACCGCCCGCAGACCATCGATGAAATGGCCGAGCTGCTGCATCTGCCAATCGCCGATGAGAACG
AAATCATCAGCACCCCTGCGGCTGCACCGGAGAACCTGCTGGTCGCCGCCAACCCGGCTGCCGCTGCGGC
CGCCGCCGGCGCCGTTACCGCGCGCGGCACCCAATTCTCGCGGCCGATGATGGCCGGCGCCGGCGTCGCT
GCGCTGCTGGTGATCGGTGCCGTCGCCTGGCTGAGCGGCGGCGAGGACGATACCCAGGCCGTGGCCCAAA
ACACTGAGGCGTCGCCGGCGCGGAAAACCCTGGCGGAACAGCCGAGCGCGCCGCAAACCGCGCAGCCTGC
AGCCGCGGAACCTGAAAAGGTGGCACCGCCACCGCAGCCGGTGGCGTTGGTGTACTTCAAACTGCAACCG
GGCGAACAGGTCAGCCTCGACGGCAAGCCGCAGCAGGTGACGCCGGGCGCAAACGGCTTCGCCAGCCTGA
ACCTGGCGCCGGGCCGCTATCAGCTGGAAATCCGCCACGACGATCGACTCCGCCGGCAGCAACTCAGCAT
CGACACCGCCGGCACCTGGCTGGTCAATCCGGCCACCGCCGGTTAA

Reference
(1) Adam Ostrowski, Francesca R Cianfanelli, Michael Porter, Giuseppina Mariano, Julien Peltier, Jun Jie Wong, Jason R Swedlow, Matthias Trost, Sarah J Coulthurst (2018). Killing With Proficiency: Integrated Post-Translational Regulation of an Offensive Type VI Secretion System. PLoS Pathog. 14(7):e1007230. [PudMed:30052683] experimental
 
experimental experimental literature