SecReT6
Regulator Protein ID: 560174112
SecReT6 ID929
T6SS typeN/A
Gene symbol-
Locus tagSMDB11_2269
StrainSerratia marcescens Db10
RepliconT6SS [GenBank: HG326223] [Browse all T6SS(s) in this replicon]
Location [Strand]2391034..2392020 [+]
Producthypothetical protein
Regulator typeprotein
Homologous effectorSMDB11_2269 (RtkS)
UniProt IDNA
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 328 a.a.     [Download]
>gi|560174112|ref|CDG12844.1| hypothetical protein [Serratia marcescens subsp. marcescens Db11]
MKYWMPGLVALMAVPTAQAMNYRLVYSPSQKLEVFIDDVKNSNPASWCGKSIPLRIVSAQSQDPAVLNDF
LPRVGNLLEKQCPKAGHLPWTLTDKRGEKLASGEAAKARGWKPVVKQEAVEQPETPPQPAIPAAVAVTSP
QADTAPPQRFSLPQGCHFRTFWGDEANGGALFIPAGEALRCGEDGWLQGSGAVTLQQGGQTLSPTLWFLQ
GYPLAKVNGGDRALTVVSANAQRLVLGGNPQAPGSFLLLSFEPKLHAWAFNGEAIVEMPRVDAADENKVK
QHVQQAQTAWQPLLSAPAPLTFKLVEKLAADRVDPASGSYLSVNGATH
-
Nucleotide Sequence: 987 bp     [Download]
>gi|560171871|ref|HG326223.1|:2391034-2392020 Serratia marcescens subsp. marcescens Db11 chromosome, complete genome
ATGAAATATTGGATGCCGGGGCTCGTCGCCCTGATGGCGGTGCCGACCGCGCAGGCGATGAACTATCGCC
TGGTTTACTCCCCCAGCCAGAAGCTGGAAGTGTTTATCGATGACGTCAAAAACAGCAATCCGGCAAGCTG
GTGCGGCAAGAGCATCCCGCTGCGCATCGTCTCGGCGCAAAGCCAGGATCCGGCGGTGCTGAACGACTTC
CTGCCGCGCGTCGGCAATCTGTTGGAAAAGCAGTGCCCGAAAGCCGGCCACCTGCCCTGGACGCTGACCG
ACAAGCGCGGTGAGAAGCTGGCCAGCGGCGAAGCCGCCAAAGCGCGCGGCTGGAAACCGGTGGTCAAACA
GGAGGCCGTCGAGCAGCCGGAAACCCCGCCGCAGCCGGCTATCCCTGCTGCAGTGGCCGTGACTTCTCCG
CAGGCGGACACCGCGCCGCCTCAGCGTTTCAGCCTGCCGCAGGGCTGCCACTTCCGCACCTTCTGGGGTG
ACGAAGCCAACGGCGGCGCGCTATTCATTCCCGCTGGTGAGGCGCTGCGCTGCGGCGAGGACGGCTGGCT
GCAGGGCAGCGGCGCGGTCACGCTGCAACAGGGCGGCCAAACCCTCTCGCCGACGCTGTGGTTCCTGCAA
GGTTACCCGCTGGCGAAGGTGAACGGCGGCGATCGCGCGCTGACCGTCGTCAGCGCCAACGCCCAACGGC
TGGTTTTGGGCGGCAACCCGCAGGCGCCGGGCAGCTTCCTGCTGCTGAGCTTCGAACCGAAGCTGCACGC
CTGGGCGTTCAACGGTGAAGCGATCGTTGAAATGCCGCGCGTCGATGCCGCCGACGAGAACAAGGTCAAA
CAGCACGTACAGCAGGCGCAAACCGCCTGGCAGCCGCTGCTAAGCGCCCCCGCCCCGCTGACCTTCAAGC
TGGTGGAAAAGCTGGCCGCAGACCGCGTCGATCCTGCCAGCGGCAGCTACCTGTCGGTTAACGGCGCCAC
TCACTGA

Reference
(1) Adam Ostrowski, Francesca R Cianfanelli, Michael Porter, Giuseppina Mariano, Julien Peltier, Jun Jie Wong, Jason R Swedlow, Matthias Trost, Sarah J Coulthurst (2018). Killing With Proficiency: Integrated Post-Translational Regulation of an Offensive Type VI Secretion System. PLoS Pathog. 14(7):e1007230. [PudMed:30052683] experimental
 
experimental experimental literature