SecReT6
Regulator Protein ID: 560174111
SecReT6 ID929
T6SS typeN/A
Gene symbol-
Locus tagSMDB11_2268
StrainSerratia marcescens Db10
RepliconT6SS [GenBank: HG326223] [Browse all T6SS(s) in this replicon]
Location [Strand]2390232..2391005 [+]
Producttype VI secretion system, serine/threonine protein phosphatase, PppA-like
Regulator typeprotein
Homologous effectorSMDB11_2268 (PppA)
UniProt IDNA
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam PP2C_2 [PF13672], Evalue: 3.6e-14, Aligned region: 6..234
PP2C [PF00481], Evalue: 1.0e-08, Aligned region: 4..140
SpoIIE [PF07228], Evalue: 1.7e-06, Aligned region: 30..233
Protein Sequence: 257 a.a.     [Download]
>gi|560174111|ref|CDG12843.1| type VI secretion system, serine/threonine protein phosphatase, PppA-like [Serratia marcescens subsp. marcescens Db11]
MNITIASTSNQGGRASNQDQTGEVLGNRAACFVVCDGIAGFPGGDIAAKLARDTILQNFDGEKHLNAQSI
RQHITSANAAIHQQQRQSDEYSKMGTTLVSLFIDRDYQLAYWAHAGDSRLYLFRRGYLHTVTTDHSLIQQ
MQDAGYQTNGINSNLLYFALGLNEERDATYSDVLQLEDGDVFLLCTDGFWHSFSQAELEQSLHMVNSPSE
WIALMQQAWKKNNNSDNYSAIAVWIGSPQETTLLHSLADAERFLSRD
-
Nucleotide Sequence: 774 bp     [Download]
>gi|560171871|ref|HG326223.1|:2390232-2391005 Serratia marcescens subsp. marcescens Db11 chromosome, complete genome
ATGAATATCACCATAGCCTCTACCTCCAACCAGGGCGGCCGCGCCTCCAACCAGGATCAGACCGGCGAGG
TGCTCGGCAACCGCGCCGCCTGCTTCGTGGTGTGCGACGGCATCGCCGGTTTTCCGGGCGGCGATATCGC
CGCCAAACTGGCACGCGACACCATTTTGCAAAACTTCGACGGCGAAAAGCACCTGAACGCCCAGAGCATT
CGTCAGCACATCACCAGCGCCAACGCCGCCATCCACCAGCAGCAGCGGCAGTCGGACGAATACAGCAAGA
TGGGCACCACGCTGGTCAGTCTGTTTATCGATCGCGATTACCAGCTGGCCTACTGGGCGCACGCCGGCGA
CAGCCGCCTGTACCTGTTCCGCCGCGGCTACCTGCATACCGTCACCACCGACCACAGCCTGATCCAACAG
ATGCAGGACGCCGGCTACCAGACCAACGGCATCAACAGCAACCTGCTGTATTTCGCGCTGGGGCTCAACG
AAGAGCGCGACGCCACCTACAGCGACGTGCTGCAGCTGGAAGACGGCGACGTTTTCCTGCTGTGCACCGA
CGGCTTCTGGCACAGCTTCAGCCAGGCCGAACTGGAACAGTCGCTGCATATGGTCAACTCCCCCAGCGAG
TGGATCGCCCTGATGCAGCAGGCATGGAAGAAAAACAATAACAGCGATAACTACAGCGCTATCGCCGTCT
GGATTGGCTCACCGCAGGAAACCACCCTGCTGCATTCGCTGGCGGATGCGGAGCGGTTTCTGAGCCGCGA
CTGA

Reference
(1) Adam Ostrowski, Francesca R Cianfanelli, Michael Porter, Giuseppina Mariano, Julien Peltier, Jun Jie Wong, Jason R Swedlow, Matthias Trost, Sarah J Coulthurst (2018). Killing With Proficiency: Integrated Post-Translational Regulation of an Offensive Type VI Secretion System. PLoS Pathog. 14(7):e1007230. [PudMed:30052683] experimental
 
experimental experimental literature